PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015932-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 327aa    MW: 37366.2 Da    PI: 8.5559
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015932-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181762147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
    NNU_015932-RA 17 RGHWRPAEDEKLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 62
                     899*****************************.***********996 PP

2Myb_DNA-binding60.34.1e-1969112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
    NNU_015932-RA  69 RRPFTEEEEERLLAAHRIHGNK-WALIARLFP-GRTDNAVKNHWHV 112
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.8441263IPR017930Myb domain
SMARTSM007173.9E-151665IPR001005SANT/Myb domain
SuperFamilySSF466898.24E-3016110IPR009057Homeodomain-like
PfamPF002491.5E-171762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-271870IPR009057Homeodomain-like
CDDcd001671.61E-142061No hitNo description
PROSITE profilePS5129428.01964118IPR017930Myb domain
SMARTSM007172.4E-1668116IPR001005SANT/Myb domain
PfamPF002496.6E-1669111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2171117IPR009057Homeodomain-like
CDDcd001675.70E-880111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEDSGSGASD DGKTCPRGHW RPAEDEKLRQ LVEQYGPQNW NSIAEKLQGR SGKSCRLRWF  60
NQLDPRINRR PFTEEEEERL LAAHRIHGNK WALIARLFPG RTDNAVKNHW HVIMARKHRE  120
RSKLYGKRGC QNFFLRNSSA SSHDYGKCSR PQIENQSKEF QFNRSEFLEF QSHGKDGVFE  180
VSPSSSPQTW VFSSSMNTTS TQSVDTFHGG GRDYFSSSCC IMGSSHTSDL QPRYSCYTNS  240
SLYSGCRNFS VPLLPNYKGF TYTQHGNPNQ SDHGYENNKM IKSTELERFG DNGLTPKFRM  300
TTDQEQGDDS KHKDVPFIDF LGVGISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-32171174104C-Myb DNA-Binding Domain
1msf_C3e-32171174104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270380.10.0PREDICTED: transcription factor MYB23
TrEMBLA0A067H7L11e-110A0A067H7L1_CITSI; Uncharacterized protein
TrEMBLV4TD411e-110V4TD41_9R
STRINGVIT_18s0001g15260.t011e-106(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-65myb domain protein 52